PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g09615.1.p
Common NameBRADI_1g09615, LOC100839252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 798aa    MW: 83570.5 Da    PI: 7.1158
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g09615.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-095776141954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Bradi1g09615.1.p 577 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 614
                       554459******************************88 PP

2BELL120.28.8e-39438508272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia+q+
  Bradi1g09615.1.p 438 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIASQL 508
                       779******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.9E-70358506IPR006563POX domain
PfamPF075263.3E-53363505IPR006563POX domain
PROSITE profilePS5007112.6555618IPR001356Homeobox domain
CDDcd000863.55E-13558619No hitNo description
SMARTSM003891.5E-9558622IPR001356Homeobox domain
SuperFamilySSF466893.08E-17560625IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28561624IPR009057Homeodomain-like
PfamPF059204.1E-18575614IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 798 aa     Download sequence    Send to blast
MGVVAPPCQP TTTTQVSQPK SGGAAIRPAT GAYSMSHSQG FHQQGSSGVY GFSSDGFVDR  60
PGSSSQEHQQ EQQQQHVAQQ SRRDKLRVQQ GFVDPAAGGG AHGGLLPALD GDEHGGAMYD  120
HAAAAGASNM LAEMFNFSAH QTPPSATELL ASQMNSANYR FGFRQPPGDG GWFGSAGGRA  180
GGLGLGGPAH LGSLGETSSS PKHQQQAAGA TMAGLAATDP AAAMQLFLMN PQQQQQSRSS  240
PTSPPPSDAQ SAIQHHEAFQ AFGASNSYGT GSGVVEGHGG QGLSLSLSPS LQQLEMAKQQ  300
AEELRVRDGV LYFNRQQQQQ QQQVQVQQLP MALHGGQVGA SLAVAGQQLH VGYGPGPAGV  360
AGVLRNSKYT RAAQELLDEF CSVGRGGQTI KAAGRAGAGA SNPNASKGGG GASSSGAGAQ  420
SPSSASKMEP PQLSPADRFE HQRKKAKLIS MLDEVDRRYN HYCDQMQMVV NFFDSVMGFG  480
AATPYTALAQ KAMSRHFRCL KDAIASQLRH TCELLGEKDA GTSSGLTKGE TPRLRAIDQS  540
LRQQRAFHHM GMMEQEAWRP QRGLPERSVS ILRSWLFEHF LHPYPSDADK HLLARQTGLS  600
RNQVSNWFIN ARVRLWKPMI EEMYQQETKE LEGSSAPESG NNDPSGAGAA DEMHSPTTQP  660
QGMLMQHGAG SRYGQHQQQE HQHGMAMLSG VHPHKLDPGA VAGPSSSDAA AFVGLDPAEL  720
LAGGDVVGGP GDDLYGRFEA AGVRMRYGPG PGPGPGAATS GAAAGDVSLT LGLQHAGPGN  780
AGPDGSGRFS LRDYSGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16564621158Homeobox protein Meis1
4xrs_B1e-16564621158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230386.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-136BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLI1GNM30.0I1GNM3_BRADI; Uncharacterized protein
STRINGBRADI1G09615.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-127BEL1-like homeodomain 4